PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000528111
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family GATA
Protein Properties Length: 244aa    MW: 27470.9 Da    PI: 9.5434
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000528111genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA56.63.5e-18146180135
           GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
                    C++C + kTp+WR gp g+ktLCnaCG++y++ +l
  MDP0000528111 146 CTHCASEKTPQWRAGPMGPKTLCNACGVRYKSGRL 180
                    *******************************9885 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004012.6E-17140190IPR000679Zinc finger, GATA-type
PROSITE profilePS5011411.332140176IPR000679Zinc finger, GATA-type
SuperFamilySSF577164.28E-15142203No hitNo description
Gene3DG3DSA:3.30.50.103.8E-14144178IPR013088Zinc finger, NHR/GATA-type
CDDcd002027.26E-13145192No hitNo description
PfamPF003204.5E-16146180IPR000679Zinc finger, GATA-type
PROSITE patternPS003440146171IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 244 aa     Download sequence    Send to blast
MEDFFPVXDL LDLSNDALFS PSAASSTDSM DLHHHPPPXD HLHGTTTTTS XFAPATTYTD  60
FTNNLLMTWR NWSGYRASST TPLPXSPTTD LTGSASFQNE ASFMFPSRVR TKRSKWAGPX  120
XPQNXPARPN RPKREPSEAS PSPLRCTHCA SEKTPQWRAG PMGPKTLCNA CGVRYKSGRL  180
VPEYRPAASP TFVLTQHSNS HRKVLELRRQ KEASQQQAPQ EQPQQHRPHQ QQFYLHRDEF  240
RVC*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mdo.117910.0fruit| leaf| root
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009348862.11e-127PREDICTED: LOW QUALITY PROTEIN: GATA transcription factor 4-like
SwissprotO497432e-42GATA4_ARATH; GATA transcription factor 4
SwissprotO826322e-42GATA9_ARATH; GATA transcription factor 9
TrEMBLD9ZIZ61e-115D9ZIZ6_MALDO; GATA domain class transcription factor
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF135501925
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G60530.13e-40GATA transcription factor 4